PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054893.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 386aa    MW: 42597.2 Da    PI: 5.7951
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054893.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-31228283156
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                   k+r++W++eLH+ F++a++qLGG+++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  EcC054893.20 228 KQRRCWSTELHRGFLHALQQLGGPDVATPKQIREVMKVDGLTNDEVKSHLQKYRLH 283
                   79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-27225286IPR009057Homeodomain-like
PROSITE profilePS5129412.398225285IPR017930Myb domain
SuperFamilySSF466896.18E-17226285IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26228283IPR006447Myb domain, plants
PfamPF002491.6E-5230281IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MESWKRGKKK KMEYPERTRS YVEALEEERR KIQVFERELP LCLELVIQAI ERCKQQLSVQ  60
GQSSECNSEQ TSMDGGRVLE EFIPLKGPYS GDDDEDDACE EEDDGDGDGD GDVHHSSRDD  120
KSGDDNAMEK SDWLRSAQLW NPNPDPIPHR EVQDPPPPPP PSKEVAAVAN QLKSHESGAF  180
RPFRIGENNS TKKKQPPGRA APPAPDAAAC STAETASGRT SRQAAQRKQR RCWSTELHRG  240
FLHALQQLGG PDVATPKQIR EVMKVDGLTN DEVKSHLQKY RLHARRPSPN GHNNANAEAP  300
QFLVVGGIWM QPPGFPAVAT GKLPLEAASN RVYAPVTMLP QPLGPSHKEC GFVTSEERGS  360
QSEVGVDHFN NSSSTTSSST HMTVDL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010044289.10.0PREDICTED: uncharacterized protein LOC104433298
TrEMBLA0A059D6Z41e-136A0A059D6Z4_EUCGR; Uncharacterized protein
STRINGVIT_01s0011g03110.t014e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.18e-73G2-like family protein